Lineage for d1pj0a_ (1pj0 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911853Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 911887Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)
  8. 911906Domain d1pj0a_: 1pj0 A: [94714]
    complexed with fe, hg; mutant

Details for d1pj0a_

PDB Entry: 1pj0 (more details), 1.9 Å

PDB Description: ribonucleotide reductase r2-d84e/w48f mutant soaked with ferrous ions at neutral ph
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1pj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsfffrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOPe Domain Coordinates for d1pj0a_:

Click to download the PDB-style file with coordinates for d1pj0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pj0a_: