Lineage for d1piea2 (1pie A:214-396)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207005Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1207056Family d.58.26.7: Galactokinase [103011] (1 protein)
  6. 1207057Protein Galactokinase [103012] (3 species)
  7. 1207063Species Lactococcus lactis [TaxId:1358] [103013] (1 PDB entry)
  8. 1207064Domain d1piea2: 1pie A:214-396 [94707]
    Other proteins in same PDB: d1piea1
    complexed with gla, po4

Details for d1piea2

PDB Entry: 1pie (more details), 2.1 Å

PDB Description: crystal structure of lactococcus lactis galactokinase complexed with galactose
PDB Compounds: (A:) Galactokinase

SCOPe Domain Sequences for d1piea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piea2 d.58.26.7 (A:214-396) Galactokinase {Lactococcus lactis [TaxId: 1358]}
dydivimntnkpralteskynerfaetrealkrmqtrldiqslgelsneefdantdligd
etlikrarhavyennrtkiaqkafvagnltkfgellnashaslkddyevtgleldtlaet
aqkqagvlgarmtgagfggcaialvahdnvsafrkavgqvyeevvgypasfyvaqigsgs
tkl

SCOPe Domain Coordinates for d1piea2:

Click to download the PDB-style file with coordinates for d1piea2.
(The format of our PDB-style files is described here.)

Timeline for d1piea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1piea1