Lineage for d1piea2 (1pie A:214-396)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) 
common fold is elaborated with additional secondary structures
Family d.58.26.7: Galactokinase [103011] (1 protein) Protein Galactokinase [103012] (2 species) Species Lactococcus lactis [TaxId:1358] [103013] (1 PDB entry) 
Domain d1piea2: 1pie A:214-396 [94707]
Other proteins in same PDB: d1piea1
complexed with gal, po4
Details for d1piea2
PDB Entry: 1pie (more details), 2.1 Å
PDB Description: crystal structure of lactococcus lactis galactokinase complexed with galactose
SCOP Domain Sequences for d1piea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1piea2 d.58.26.7 (A:214-396) Galactokinase {Lactococcus lactis}
dydivimntnkpralteskynerfaetrealkrmqtrldiqslgelsneefdantdligd
etlikrarhavyennrtkiaqkafvagnltkfgellnashaslkddyevtgleldtlaet
aqkqagvlgarmtgagfggcaialvahdnvsafrkavgqvyeevvgypasfyvaqigsgs
tkl
SCOP Domain Coordinates for d1piea2:
Click to download the PDB-style file with coordinates for d1piea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1piea2:
- d1piea2 is new in SCOP 1.67
- d1piea2 appears in SCOP 1.69
- d1piea2 appears in the current release, SCOPe 2.08
View in 3D
