Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
Protein Galactokinase [102762] (3 species) |
Species Lactococcus lactis [TaxId:1358] [102763] (1 PDB entry) |
Domain d1piea1: 1pie A:9-213 [94706] Other proteins in same PDB: d1piea2 complexed with gla, po4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1pie (more details), 2.1 Å
SCOPe Domain Sequences for d1piea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [TaxId: 1358]} tvlsaltekfaevfgdtkeveyffspgrinligehtdynggyvfpasitigttglarlre dkkvklysenfpklgviefdldevekkdgelwsnyvkgmivmlkgagyeidkgfellikg eiptasglsssaslellvgvvlddlfnlnvprlelvqlgqktendyigvnsgildqfaig fgevkkaieldcntlkyemvpvelr
Timeline for d1piea1: