Lineage for d1piea1 (1pie A:9-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930509Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2930518Protein Galactokinase [102762] (3 species)
  7. 2930524Species Lactococcus lactis [TaxId:1358] [102763] (1 PDB entry)
  8. 2930525Domain d1piea1: 1pie A:9-213 [94706]
    Other proteins in same PDB: d1piea2
    complexed with gla, po4
    has additional insertions and/or extensions that are not grouped together

Details for d1piea1

PDB Entry: 1pie (more details), 2.1 Å

PDB Description: crystal structure of lactococcus lactis galactokinase complexed with galactose
PDB Compounds: (A:) Galactokinase

SCOPe Domain Sequences for d1piea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [TaxId: 1358]}
tvlsaltekfaevfgdtkeveyffspgrinligehtdynggyvfpasitigttglarlre
dkkvklysenfpklgviefdldevekkdgelwsnyvkgmivmlkgagyeidkgfellikg
eiptasglsssaslellvgvvlddlfnlnvprlelvqlgqktendyigvnsgildqfaig
fgevkkaieldcntlkyemvpvelr

SCOPe Domain Coordinates for d1piea1:

Click to download the PDB-style file with coordinates for d1piea1.
(The format of our PDB-style files is described here.)

Timeline for d1piea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1piea2