Lineage for d1pgya_ (1pgy A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636364Protein Auxilin-like protein Swa2p [101065] (1 species)
  7. 636365Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101066] (1 PDB entry)
  8. 636366Domain d1pgya_: 1pgy A: [94696]

Details for d1pgya_

PDB Entry: 1pgy (more details)

PDB Description: Solution structure of the UBA domain in Saccharomyces cerevisiae protein, Swa2p
PDB Compounds: (A:) Swa2p

SCOP Domain Sequences for d1pgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgya_ a.5.2.1 (A:) Auxilin-like protein Swa2p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
alvdevkdmeiarlmslglsieeatefyendvtyeryleilkskqke

SCOP Domain Coordinates for d1pgya_:

Click to download the PDB-style file with coordinates for d1pgya_.
(The format of our PDB-style files is described here.)

Timeline for d1pgya_: