SCOPe 2.02: Domain d1pg7z2: 1pg7 Z:114-213

Lineage for d1pg7z2 (1pg7 Z:114-213)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1pg7z2: 1pg7 Z:114-213 [94689]
   Other proteins in same PDB: d1pg7h1, d1pg7i1, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7y1, d1pg7y2, d1pg7z1
   part of Fab 6A6

Details for d1pg7z2

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (Z:) murine antibody 6A6 Fab fragment

SCOPe Domain Sequences for d1pg7z2:

Sequence; same for both SEQRES and ATOM records:

>d1pg7z2 b.1.1.2 (Z:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsvtcnvahpasstkvdkkivpk

Timeline for d1pg7z2:

• d1pg7z2 first appeared in SCOP 1.67
  
• d1pg7z2 appears in SCOPe 2.01
  
• d1pg7z2 appears in SCOPe 2.03
  
• d1pg7z2 appears in the current release, SCOPe 2.08