SCOPe 2.06: Domain d1pg7y2: 1pg7 Y:109-206

Lineage for d1pg7y2 (1pg7 Y:109-206)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d1pg7y2: 1pg7 Y:109-206 [94687]
   Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7x1, d1pg7x2, d1pg7y1, d1pg7z1, d1pg7z2
   part of Fab 6A6

Details for d1pg7y2

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (Y:) murine antibody 6A6 Fab fragment

SCOPe Domain Sequences for d1pg7y2:

Sequence; same for both SEQRES and ATOM records:

>d1pg7y2 b.1.1.2 (Y:109-206) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvnlfppsseelktkkatlvctitefypgavrvdwkadgtpvtqgdettqpskq
snnkymassyltltaeaweshssyschvthegqsveksls

Timeline for d1pg7y2:

• d1pg7y2 first appeared in SCOP 1.67
  
• d1pg7y2 appears in SCOPe 2.05
  
• d1pg7y2 appears in SCOPe 2.07
  
• d1pg7y2 appears in the current release, SCOPe 2.08