SCOP 1.73: Domain d1pg7x1: 1pg7 X:1-113

Lineage for d1pg7x1 (1pg7 X:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1pg7x1: 1pg7 X:1-113 [94684]
   Other proteins in same PDB: d1pg7h2, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z2

Details for d1pg7x1

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (X:) murine antibody 6A6 Fab fragment

SCOP Domain Sequences for d1pg7x1:

Sequence; same for both SEQRES and ATOM records:

>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgpelvkpgasvkisckasgysftghllnwvkqshgknlewiglvhphngaity
nqkfkdkatltvdrssttayielvrltsndsavyycaredfryhysmdywgqgtsvtvss

Timeline for d1pg7x1:

• d1pg7x1 first appeared in SCOP 1.67
  
• d1pg7x1 appears in SCOP 1.71
  
• d1pg7x1 appears in SCOP 1.75
  
• d1pg7x1 appears in the current release, SCOPe 2.08