Lineage for d1pg7w2 (1pg7 W:109-206)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293989Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1293993Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1294024Domain d1pg7w2: 1pg7 W:109-206 [94683]
    Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7x1, d1pg7x2, d1pg7y1, d1pg7z1, d1pg7z2
    part of Fab 6A6

Details for d1pg7w2

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab
PDB Compounds: (W:) murine antibody 6A6 Fab fragment

SCOPe Domain Sequences for d1pg7w2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7w2 b.1.1.2 (W:109-206) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpksspsvnlfppsseelktkkatlvctitefypgavrvdwkadgtpvtqgdettqpskq
snnkymassyltltaeaweshssyschvthegqsveksls

SCOPe Domain Coordinates for d1pg7w2:

Click to download the PDB-style file with coordinates for d1pg7w2.
(The format of our PDB-style files is described here.)

Timeline for d1pg7w2: