Lineage for d1pg7w1 (1pg7 W:1-108)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364057Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 364136Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)
  8. 364178Domain d1pg7w1: 1pg7 W:1-108 [94682]
    Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w2, d1pg7x1, d1pg7x2, d1pg7y2, d1pg7z1, d1pg7z2

Details for d1pg7w1

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

SCOP Domain Sequences for d1pg7w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7w1 b.1.1.1 (W:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qavvtqesaltsspgetvtltcrsstgavttsnyanwvqekpdhlftgviggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOP Domain Coordinates for d1pg7w1:

Click to download the PDB-style file with coordinates for d1pg7w1.
(The format of our PDB-style files is described here.)

Timeline for d1pg7w1: