| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
| Domain d1pg7i2: 1pg7 I:118-213 [94677] Other proteins in same PDB: d1pg7h1, d1pg7i1, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7y1, d1pg7y2, d1pg7z1 part of humanized Fab D3H44 against human tissue factor |
PDB Entry: 1pg7 (more details), 2.5 Å
SCOPe Domain Sequences for d1pg7i2:
Sequence, based on SEQRES records: (download)
>d1pg7i2 b.1.1.2 (I:118-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
>d1pg7i2 b.1.1.2 (I:118-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d1pg7i2: