SCOPe 2.04: Domain d1pg7i1: 1pg7 I:1-117

Lineage for d1pg7i1 (1pg7 I:1-117)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Engineered (including hybrid species) [88562] (68 PDB entries)
SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

Domain d1pg7i1: 1pg7 I:1-117 [94676]
Other proteins in same PDB: d1pg7h2, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z2
part of humanized Fab D3H44 against human tissue factor

Details for d1pg7i1

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (I:) humanized antibody D3H44

SCOPe Domain Sequences for d1pg7i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7i1 b.1.1.1 (I:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
k

SCOPe Domain Coordinates for d1pg7i1:

Click to download the PDB-style file with coordinates for d1pg7i1.
(The format of our PDB-style files is described here.)

Timeline for d1pg7i1: