Lineage for d1pg7h2 (1pg7 H:118-213)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549102Domain d1pg7h2: 1pg7 H:118-213 [94675]
    Other proteins in same PDB: d1pg7h1, d1pg7i1, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7y1, d1pg7y2, d1pg7z1

Details for d1pg7h2

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

SCOP Domain Sequences for d1pg7h2:

Sequence, based on SEQRES records: (download)

>d1pg7h2 b.1.1.2 (H:118-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1pg7h2 b.1.1.2 (H:118-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
gpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1pg7h2:

Click to download the PDB-style file with coordinates for d1pg7h2.
(The format of our PDB-style files is described here.)

Timeline for d1pg7h2: