SCOP 1.67: Domain d1pg7h2: 1pg7 H:118-213

Lineage for d1pg7h2 (1pg7 H:118-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1pg7h2: 1pg7 H:118-213 [94675]
   Other proteins in same PDB: d1pg7h1, d1pg7i1, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7y1, d1pg7y2, d1pg7z1

Details for d1pg7h2

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

SCOP Domain Sequences for d1pg7h2:

Sequence, based on SEQRES records:

>d1pg7h2 b.1.1.2 (H:118-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1pg7h2 b.1.1.2 (H:118-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
gpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1pg7h2:

• d1pg7h2 is new in SCOP 1.67
  
• d1pg7h2 appears in SCOP 1.69
  
• d1pg7h2 appears in the current release, SCOPe 2.08