SCOPe 2.05: Domain d1pg6a_: 1pg6 A:

Lineage for d1pg6a_ (1pg6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.2: PA3696/SPS0176-like [101995] (2 proteins)
   duplication: there are three structural repeats per subunit; nine domains per ring-like trimer
   automatically mapped to Pfam PF01987

6. Protein Hypothetical protein SPyM3_0169 (SPyM18_0222, SPS0176) [101996] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [101997] (1 PDB entry)

8. Domain d1pg6a_: 1pg6 A: [94673]
   structural genomics; NESG target DR2
   complexed with ca

Details for d1pg6a_

PDB Entry: 1pg6, 1.7 Å

PDB Description: X-Ray Crystal Structure of Protein SPYM3_0169 from Streptococcus pyogenes. Northeast Structural Genomics Consortium Target DR2.

PDB Compounds: (A:) Hypothetical protein SpyM3_0169

SCOPe Domain Sequences for d1pg6a_:

Sequence, based on SEQRES records:

>d1pg6a_ b.82.5.2 (A:) Hypothetical protein SPyM3_0169 (SPyM18_0222, SPS0176) {Streptococcus pyogenes [TaxId: 1314]}
rmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklngkgsglgklvgaig
rsmvsgesmfitqamsngdgklalapntpgqivalelgekqyrlndgaflaldgsaqykm
erqnigkalfggqgglfvmtteglgtllansfgsikkitldggtmtidnahvvawsreld
ydihlengfmqsigtgegvvntfrghgeiyiqslnleqfagtlkryl

Sequence, based on observed residues (ATOM records):

>d1pg6a_ b.82.5.2 (A:) Hypothetical protein SPyM3_0169 (SPyM18_0222, SPS0176) {Streptococcus pyogenes [TaxId: 1314]}
rmrftidqnmqfplveidlehggsvylqqgsmvyhtenvtlntklnglgklvgaigrsmv
sgesmfitqamsngdgklalapntpgqivalelgekqyrlndgaflaldgsaqykmerqn
iggglfvmtteglgtllansfgsikkitldggtmtidnahvvawsreldydihlengfmq
sigtgegvvntfrghgeiyiqslnleqfagtlkryl

Timeline for d1pg6a_:

• d1pg6a_ first appeared in SCOP 1.67
  
• d1pg6a_ appears in SCOPe 2.04
  
• d1pg6a_ appears in SCOPe 2.06
  
• d1pg6a_ appears in the current release, SCOPe 2.08