SCOPe 2.05: Domain d1pg2a1: 1pg2 A:389-550

Lineage for d1pg2a1 (1pg2 A:389-550)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
   this domain follows the Rossmann-fold catalytic domain of class I aaRS

7. Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)

8. Domain d1pg2a1: 1pg2 A:389-550 [94671]
   Other proteins in same PDB: d1pg2a2
   protein/RNA complex; complexed with adn, met

Details for d1pg2a1

PDB Entry: 1pg2, 1.75 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with methionine and adenosine

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pg2a1:

Sequence; same for both SEQRES and ATOM records:

>d1pg2a1 a.27.1.1 (A:389-550) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaskeev

Timeline for d1pg2a1:

• d1pg2a1 first appeared in SCOP 1.67
  
• d1pg2a1 appears in SCOPe 2.04
  
• d1pg2a1 appears in SCOPe 2.06
  
• d1pg2a1 appears in the current release, SCOPe 2.08