Class a: All alpha proteins [46456] (290 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species) this domain follows the Rossmann-fold catalytic domain of class I aaRS |
Species Escherichia coli [TaxId:562] [47327] (9 PDB entries) |
Domain d1pg0a1: 1pg0 A:389-550 [94669] Other proteins in same PDB: d1pg0a2 complexed with mod |
PDB Entry: 1pg0 (more details), 1.9 Å
SCOPe Domain Sequences for d1pg0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pg0a1 a.27.1.1 (A:389-550) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt eltwdgiqqpllghkvnpfkalynridmrqvealveaskeev
Timeline for d1pg0a1: