Class g: Small proteins [56992] (72 folds) |
Fold g.41: Rubredoxin-like [57769] (13 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family) |
Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein) |
Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (1 species) |
Species Escherichia coli [TaxId:562] [57773] (9 PDB entries) |
Domain d1pfya3: 1pfy A:141-175 [94668] Other proteins in same PDB: d1pfya1, d1pfya2 complexed with msp, zn |
PDB Entry: 1pfy (more details), 1.93 Å
SCOP Domain Sequences for d1pfya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfya3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli} vkgtcpkckspdqygdncevcgatyspteliepks
Timeline for d1pfya3: