Lineage for d1pfwa1 (1pfw A:389-549)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993200Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1993201Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1993202Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1993231Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 1993232Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)
  8. 1993234Domain d1pfwa1: 1pfw A:389-549 [94663]
    Other proteins in same PDB: d1pfwa2, d1pfwa3
    protein/RNA complex; complexed with mf3, zn

Details for d1pfwa1

PDB Entry: 1pfw (more details), 1.78 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with trifluoromethionine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pfwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfwa1 a.27.1.1 (A:389-549) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaskee

SCOPe Domain Coordinates for d1pfwa1:

Click to download the PDB-style file with coordinates for d1pfwa1.
(The format of our PDB-style files is described here.)

Timeline for d1pfwa1: