Lineage for d1pfva3 (1pfv A:141-175)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430157Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family) (S)
  5. 430158Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein)
  6. 430159Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (1 species)
  7. 430160Species Escherichia coli [TaxId:562] [57773] (9 PDB entries)
  8. 430161Domain d1pfva3: 1pfv A:141-175 [94662]
    Other proteins in same PDB: d1pfva1, d1pfva2
    complexed with 2fm, zn

Details for d1pfva3

PDB Entry: 1pfv (more details), 1.7 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with difluoromethionine

SCOP Domain Sequences for d1pfva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli}
vkgtcpkckspdqygdncevcgatyspteliepks

SCOP Domain Coordinates for d1pfva3:

Click to download the PDB-style file with coordinates for d1pfva3.
(The format of our PDB-style files is described here.)

Timeline for d1pfva3: