Lineage for d1pfva2 (1pfv A:4-140,A:176-388)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 579983Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 580045Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. 580046Species Escherichia coli [TaxId:562] [52386] (9 PDB entries)
  8. 580047Domain d1pfva2: 1pfv A:4-140,A:176-388 [94661]
    Other proteins in same PDB: d1pfva1, d1pfva3
    complexed with 2fm, zn

Details for d1pfva2

PDB Entry: 1pfv (more details), 1.7 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with difluoromethionine

SCOP Domain Sequences for d1pfva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli}
akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
isqlydpekgmflpdrfXvvsgatpvmrdsehfffdlpsfsemlqawtrsgalqeqvank
mqewfesglqqwdisrdapyfgfeipnapgkyfyvwldapigymgsfknlcdkrgdsvsf
deywkkdstaelyhfigkdivyfhslfwpamlegsnfrkpsnlfvhgyvtvngakmsksr
gtfikastwlnhfdadslryyytaklssriddidlnledfvqrvnadivnk

SCOP Domain Coordinates for d1pfva2:

Click to download the PDB-style file with coordinates for d1pfva2.
(The format of our PDB-style files is described here.)

Timeline for d1pfva2: