SCOPe 2.05: Domain d1pfua2: 1pfu A:4-140,A:176-388

Lineage for d1pfua2 (1pfu A:4-140,A:176-388)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)

7. Species Escherichia coli [TaxId:562] [52386] (9 PDB entries)

8. Domain d1pfua2: 1pfu A:4-140,A:176-388 [94658]
   Other proteins in same PDB: d1pfua1, d1pfua3
   protein/RNA complex; complexed with mpj, zn

Details for d1pfua2

PDB Entry: 1pfu, 1.91 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with methionine phosphinate

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pfua2:

Sequence; same for both SEQRES and ATOM records:

>d1pfua2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
isqlydpekgmflpdrfXvvsgatpvmrdsehfffdlpsfsemlqawtrsgalqeqvank
mqewfesglqqwdisrdapyfgfeipnapgkyfyvwldapigymgsfknlcdkrgdsvsf
deywkkdstaelyhfigkdivyfhslfwpamlegsnfrkpsnlfvhgyvtvngakmsksr
gtfikastwlnhfdadslryyytaklssriddidlnledfvqrvnadivnk

Timeline for d1pfua2:

• d1pfua2 first appeared in SCOP 1.67
  
• d1pfua2 appears in SCOPe 2.04
  
• d1pfua2 appears in SCOPe 2.06
  
• d1pfua2 appears in the current release, SCOPe 2.08