Lineage for d1pfua1 (1pfu A:389-550)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991851Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 protein domains)
  6. 1991880Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 1991881Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)
  8. 1991888Domain d1pfua1: 1pfu A:389-550 [94657]
    Other proteins in same PDB: d1pfua2, d1pfua3
    protein/RNA complex; complexed with mpj, zn

Details for d1pfua1

PDB Entry: 1pfu (more details), 1.91 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with methionine phosphinate
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfua1 a.27.1.1 (A:389-550) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaskeev

SCOPe Domain Coordinates for d1pfua1:

Click to download the PDB-style file with coordinates for d1pfua1.
(The format of our PDB-style files is described here.)

Timeline for d1pfua1: