Lineage for d1pfpa_ (1pfp A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895675Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1895789Family d.17.1.3: Cathelicidin motif [82592] (2 proteins)
    cathelin-like domain
  6. 1895790Protein Cathelicidin motif of protegrin-3 [82593] (1 species)
    antimicrobial protein
  7. 1895791Species Pig (Sus scrofa) [TaxId:9823] [82594] (5 PDB entries)
  8. 1895794Domain d1pfpa_: 1pfp A: [94656]

Details for d1pfpa_

PDB Entry: 1pfp (more details), 2.3 Å

PDB Description: cathelin-like motif of protegrin-3
PDB Compounds: (A:) Protegrin 3

SCOPe Domain Sequences for d1pfpa_:

Sequence, based on SEQRES records: (download)

>d1pfpa_ d.17.1.3 (A:) Cathelicidin motif of protegrin-3 {Pig (Sus scrofa) [TaxId: 9823]}
alsyreavlravdrlneqsseanlyrlleldqppkadedpgtpkpvsftvketvaprptr
qppeladfkengrvkqavgtvtldqikdplditanevq

Sequence, based on observed residues (ATOM records): (download)

>d1pfpa_ d.17.1.3 (A:) Cathelicidin motif of protegrin-3 {Pig (Sus scrofa) [TaxId: 9823]}
alsyreavlravdrlneqsseanlyrlleldqdpgtpkpvsftvketvaprptrqppela
dfkengrvkqavgtvtldlditanevq

SCOPe Domain Coordinates for d1pfpa_:

Click to download the PDB-style file with coordinates for d1pfpa_.
(The format of our PDB-style files is described here.)

Timeline for d1pfpa_: