Lineage for d1pf9h2 (1pf9 H:191-366)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459236Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2459443Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2459444Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2459445Protein GroEL, A domain [52031] (4 species)
  7. 2459446Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 2459542Domain d1pf9h2: 1pf9 H:191-366 [94628]
    Other proteins in same PDB: d1pf9a1, d1pf9a3, d1pf9b1, d1pf9b3, d1pf9c1, d1pf9c3, d1pf9d1, d1pf9d3, d1pf9e1, d1pf9e3, d1pf9f1, d1pf9f3, d1pf9g1, d1pf9g3, d1pf9h1, d1pf9h3, d1pf9i1, d1pf9i3, d1pf9j1, d1pf9j3, d1pf9k1, d1pf9k3, d1pf9l1, d1pf9l3, d1pf9m1, d1pf9m3, d1pf9n1, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_
    complexed with adp, mg

Details for d1pf9h2

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp
PDB Compounds: (H:) groEL protein

SCOPe Domain Sequences for d1pf9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9h2 c.8.5.1 (H:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1pf9h2:

Click to download the PDB-style file with coordinates for d1pf9h2.
(The format of our PDB-style files is described here.)

Timeline for d1pf9h2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pf9a1, d1pf9a2, d1pf9a3, d1pf9b1, d1pf9b2, d1pf9b3, d1pf9c1, d1pf9c2, d1pf9c3, d1pf9d1, d1pf9d2, d1pf9d3, d1pf9e1, d1pf9e2, d1pf9e3, d1pf9f1, d1pf9f2, d1pf9f3, d1pf9g1, d1pf9g2, d1pf9g3, d1pf9i1, d1pf9i2, d1pf9i3, d1pf9j1, d1pf9j2, d1pf9j3, d1pf9k1, d1pf9k2, d1pf9k3, d1pf9l1, d1pf9l2, d1pf9l3, d1pf9m1, d1pf9m2, d1pf9m3, d1pf9n1, d1pf9n2, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_