Lineage for d1pf9d1 (1pf9 D:2-136,D:410-525)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448721Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 448722Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 448723Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 448724Protein GroEL, E domain [48594] (3 species)
  7. 448725Species Escherichia coli [TaxId:562] [48595] (9 PDB entries)
  8. 448806Domain d1pf9d1: 1pf9 D:2-136,D:410-525 [94615]
    Other proteins in same PDB: d1pf9a2, d1pf9a3, d1pf9b2, d1pf9b3, d1pf9c2, d1pf9c3, d1pf9d2, d1pf9d3, d1pf9e2, d1pf9e3, d1pf9f2, d1pf9f3, d1pf9g2, d1pf9g3, d1pf9h2, d1pf9h3, d1pf9i2, d1pf9i3, d1pf9j2, d1pf9j3, d1pf9k2, d1pf9k3, d1pf9l2, d1pf9l3, d1pf9m2, d1pf9m3, d1pf9n2, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_

Details for d1pf9d1

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp

SCOP Domain Sequences for d1pf9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9d1 a.129.1.1 (D:2-136,D:410-525) GroEL, E domain {Escherichia coli}
aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1pf9d1:

Click to download the PDB-style file with coordinates for d1pf9d1.
(The format of our PDB-style files is described here.)

Timeline for d1pf9d1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pf9a1, d1pf9a2, d1pf9a3, d1pf9b1, d1pf9b2, d1pf9b3, d1pf9c1, d1pf9c2, d1pf9c3, d1pf9e1, d1pf9e2, d1pf9e3, d1pf9f1, d1pf9f2, d1pf9f3, d1pf9g1, d1pf9g2, d1pf9g3, d1pf9h1, d1pf9h2, d1pf9h3, d1pf9i1, d1pf9i2, d1pf9i3, d1pf9j1, d1pf9j2, d1pf9j3, d1pf9k1, d1pf9k2, d1pf9k3, d1pf9l1, d1pf9l2, d1pf9l3, d1pf9m1, d1pf9m2, d1pf9m3, d1pf9n1, d1pf9n2, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_