| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
| Protein Hypothetical protein YjgH [103075] (1 species) |
| Species Escherichia coli [TaxId:562] [103076] (1 PDB entry) |
| Domain d1pf5a_: 1pf5 A: [94604] structural genomics complexed with hg |
PDB Entry: 1pf5 (more details), 2.5 Å
SCOPe Domain Sequences for d1pf5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pf5a_ d.79.1.1 (A:) Hypothetical protein YjgH {Escherichia coli [TaxId: 562]}
vertavfpagrhslyaehrysaairsgdllfvsgqvgsredgtpepdfqqqvrlafdnlh
atlaaagctfddiidvtsfhtdpenqfedimtvkneifsappypnwtavgvtwlagfdfe
ikviaripeq
Timeline for d1pf5a_: