Lineage for d1pf5a_ (1pf5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958682Protein Hypothetical protein YjgH [103075] (1 species)
  7. 2958683Species Escherichia coli [TaxId:562] [103076] (1 PDB entry)
  8. 2958684Domain d1pf5a_: 1pf5 A: [94604]
    structural genomics
    complexed with hg

Details for d1pf5a_

PDB Entry: 1pf5 (more details), 2.5 Å

PDB Description: structural genomics, protein yjgh
PDB Compounds: (A:) Hypothetical protein yjgH

SCOPe Domain Sequences for d1pf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf5a_ d.79.1.1 (A:) Hypothetical protein YjgH {Escherichia coli [TaxId: 562]}
vertavfpagrhslyaehrysaairsgdllfvsgqvgsredgtpepdfqqqvrlafdnlh
atlaaagctfddiidvtsfhtdpenqfedimtvkneifsappypnwtavgvtwlagfdfe
ikviaripeq

SCOPe Domain Coordinates for d1pf5a_:

Click to download the PDB-style file with coordinates for d1pf5a_.
(The format of our PDB-style files is described here.)

Timeline for d1pf5a_: