SCOP 1.73: Domain d1peza3: 1pez A:407-495

Lineage for d1peza3 (1pez A:407-495)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1peza3: 1pez A:407-495 [94602]
   Other proteins in same PDB: d1peza1, d1peza2, d1peza4
   complexed with acy, ca, epe, glc, mal, mpd; mutant

Details for d1peza3

PDB Entry: 1pez, 2.32 Å

PDB Description: bacillus circulans strain 251 mutant a230v

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d1peza3:

Sequence; same for both SEQRES and ATOM records:

>d1peza3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1peza3:

• d1peza3 first appeared in SCOP 1.67
  
• d1peza3 appears in SCOP 1.71
  
• d1peza3 appears in SCOP 1.75
  
• d1peza3 appears in the current release, SCOPe 2.08