SCOP 1.69: Domain d1peza2: 1pez A:582-686

Lineage for d1peza2 (1pez A:582-686)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (2 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1peza2: 1pez A:582-686 [94601]
   Other proteins in same PDB: d1peza1, d1peza3, d1peza4

Details for d1peza2

PDB Entry: 1pez, 2.32 Å

PDB Description: bacillus circulans strain 251 mutant a230v

SCOP Domain Sequences for d1peza2:

Sequence; same for both SEQRES and ATOM records:

>d1peza2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstatweggsnhtftapssgtgtinvnwqp

Timeline for d1peza2:

• d1peza2 first appeared in SCOP 1.67
  
• d1peza2 appears in SCOP 1.71
  
• d1peza2 appears in the current release, SCOPe 2.08