Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
Protein Dim-5 [82201] (1 species) |
Species Fungus (Neurospora crassa) [TaxId:5141] [82202] (2 PDB entries) |
Domain d1pega_: 1peg A: [94598] complexed with histone H3 peptide complexed with sah, zn |
PDB Entry: 1peg (more details), 2.59 Å
SCOPe Domain Sequences for d1pega_:
Sequence, based on SEQRES records: (download)
>d1pega_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} lpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqcldem apdsdeeadpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvver grtvplqifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvyl faldkfsdpdsldpllagqplevdgeymsgptrfinhscdpnmaifarvgdhadkhihdl alfaikdipkgteltfdyvngltglesdahdpskisemtkclcgtakcrgylw
>d1pega_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} lpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqcldem apdpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvvergrtvpl qifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvylfaldkf sdpdsldpllagplevdgeymsgptrfinhscdpnmaifarvgdhadkhihdlalfaikd ipkgteltfdyvnclcgtakcrgylw
Timeline for d1pega_: