Lineage for d1pega_ (1peg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073021Family b.85.7.1: Histone lysine methyltransferases [82200] (3 protein domains)
    contains metal-binding preSET and postSET domains
  6. 2073022Protein Dim-5 [82201] (1 species)
  7. 2073023Species Fungus (Neurospora crassa) [TaxId:5141] [82202] (2 PDB entries)
  8. 2073025Domain d1pega_: 1peg A: [94598]
    complexed with histone H3 peptide
    complexed with sah, zn

Details for d1pega_

PDB Entry: 1peg (more details), 2.59 Å

PDB Description: Structural basis for the product specificity of histone lysine methyltransferases
PDB Compounds: (A:) Histone H3 methyltransferase DIM-5

SCOPe Domain Sequences for d1pega_:

Sequence, based on SEQRES records: (download)

>d1pega_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]}
lpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqcldem
apdsdeeadpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvver
grtvplqifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvyl
faldkfsdpdsldpllagqplevdgeymsgptrfinhscdpnmaifarvgdhadkhihdl
alfaikdipkgteltfdyvngltglesdahdpskisemtkclcgtakcrgylw

Sequence, based on observed residues (ATOM records): (download)

>d1pega_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]}
lpisivnreddaflnpnfrfidhsiigknvpvadqsfrvgcscasdeecmystcqcldem
apdpytrkkrfayysqgakkgllrdrvlqsqepiyechqgcacskdcpnrvvergrtvpl
qifrtkdrgwgvkcpvnikrgqfvdrylgeiitseeadrrraestiarrkdvylfaldkf
sdpdsldpllagplevdgeymsgptrfinhscdpnmaifarvgdhadkhihdlalfaikd
ipkgteltfdyvnclcgtakcrgylw

SCOPe Domain Coordinates for d1pega_:

Click to download the PDB-style file with coordinates for d1pega_.
(The format of our PDB-style files is described here.)

Timeline for d1pega_: