SCOPe 2.07: Domain d1pe9b_: 1pe9 B:

Lineage for d1pe9b_ (1pe9 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
   this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain

6. Protein Pectate lyase [51128] (5 species)

7. Species Erwinia chrysanthemi, type A [TaxId:556] [75024] (4 PDB entries)

8. Domain d1pe9b_: 1pe9 B: [94596]
   mutant

Details for d1pe9b_

PDB Entry: 1pe9, 1.6 Å

PDB Description: mutations in the t1.5 loop of pectate lyase a

PDB Compounds: (B:) pectate lyase A

SCOPe Domain Sequences for d1pe9b_:

Sequence; same for both SEQRES and ATOM records:

>d1pe9b_ b.80.1.1 (B:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]}
aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
l

Timeline for d1pe9b_:

• d1pe9b_ first appeared in SCOP 1.67
  
• d1pe9b_ appears in SCOPe 2.06
  
• d1pe9b_ appears in the current release, SCOPe 2.08