Lineage for d1pe9a_ (1pe9 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676845Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 676846Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 676847Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 676852Protein Pectate lyase [51128] (5 species)
  7. 676858Species Erwinia chrysanthemi, type A [TaxId:556] [75024] (4 PDB entries)
  8. 676859Domain d1pe9a_: 1pe9 A: [94595]

Details for d1pe9a_

PDB Entry: 1pe9 (more details), 1.6 Å

PDB Description: mutations in the t1.5 loop of pectate lyase a
PDB Compounds: (A:) pectate lyase A

SCOP Domain Sequences for d1pe9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]}
aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
vqhdgaldikrgsdyvtisnslidqhdktmlighsdsngsqdkgklhvtlfnnvfnrvte
raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
l

SCOP Domain Coordinates for d1pe9a_:

Click to download the PDB-style file with coordinates for d1pe9a_.
(The format of our PDB-style files is described here.)

Timeline for d1pe9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pe9b_