Lineage for d1pe1b_ (1pe1 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385893Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 385967Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)
  7. 385968Species Aquifex aeolicus [TaxId:63363] [63922] (16 PDB entries)
  8. 385970Domain d1pe1b_: 1pe1 B: [94592]
    complexed with 2pg, cd, po4

Details for d1pe1b_

PDB Entry: 1pe1 (more details), 1.74 Å

PDB Description: Aquifex aeolicus KDO8PS in complex with cadmium and 2-PGA

SCOP Domain Sequences for d1pe1b_:

Sequence, based on SEQRES records: (download)

>d1pe1b_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

Sequence, based on observed residues (ATOM records): (download)

>d1pe1b_ c.1.10.4 (B:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpggmrefifpliraavavgcdgvfmethpepekalsdastqlplsqlegiie
aileirevaskyyeti

SCOP Domain Coordinates for d1pe1b_:

Click to download the PDB-style file with coordinates for d1pe1b_.
(The format of our PDB-style files is described here.)

Timeline for d1pe1b_: