Lineage for d1pdqa_ (1pdq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785152Protein Polycomb protein, Pc [101688] (1 species)
  7. 2785153Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101689] (2 PDB entries)
  8. 2785155Domain d1pdqa_: 1pdq A: [94590]
    complexed with histone H3 peptide containing trimethyllysine 27, chain B

Details for d1pdqa_

PDB Entry: 1pdq (more details), 1.76 Å

PDB Description: polycomb chromodomain complexed with the histone h3 tail containing trimethyllysine 27.
PDB Compounds: (A:) Polycomb protein

SCOPe Domain Sequences for d1pdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdqa_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiye

SCOPe Domain Coordinates for d1pdqa_:

Click to download the PDB-style file with coordinates for d1pdqa_.
(The format of our PDB-style files is described here.)

Timeline for d1pdqa_: