Lineage for d1pdph_ (1pdp H:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 755793Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 755794Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 755795Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 755796Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 755797Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 755859Domain d1pdph_: 1pdp H: [94579]

Details for d1pdph_

PDB Entry: 1pdp (more details)

PDB Description: fitting of gp9 structure into the bacteriophage t4 baseplate cryoem reconstruction
PDB Compounds: (H:) Baseplate structural protein Gp9

SCOP Domain Sequences for d1pdph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdph_ i.19.1.1 (H:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq

SCOP Domain Coordinates for d1pdph_:

Click to download the PDB-style file with coordinates for d1pdph_.
(The format of our PDB-style files is described here.)

Timeline for d1pdph_: