Lineage for d1pdmk_ (1pdm K:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3045435Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 3045436Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 3045437Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 3045438Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 3045439Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 3045492Domain d1pdmk_: 1pdm K: [94570]
    fitting of baseplate structural protein gp8

Details for d1pdmk_

PDB Entry: 1pdm (more details)

PDB Description: fitting of gp8 structure into the cryoem reconstruction of the bacteriophage t4 baseplate
PDB Compounds: (K:) baseplate structural protein gp8

SCOPe Domain Sequences for d1pdmk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdmk_ i.19.1.1 (K:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl
gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga
gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy
vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant
irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs
gemiymenrppiimamdqteeinilftf

SCOPe Domain Coordinates for d1pdmk_:

Click to download the PDB-style file with coordinates for d1pdmk_.
(The format of our PDB-style files is described here.)

Timeline for d1pdmk_: