Lineage for d1pdir_ (1pdi R:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3045435Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 3045436Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 3045437Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 3045438Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 3045439Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 3045475Domain d1pdir_: 1pdi R: [94553]
    fitting of short tail fiber protein gp12

Details for d1pdir_

PDB Entry: 1pdi (more details)

PDB Description: fitting of the c-terminal part of the short tail fibers into the cryo- em reconstruction of t4 baseplate
PDB Compounds: (R:) Short tail fiber protein

SCOPe Domain Sequences for d1pdir_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdir_ i.19.1.1 (R:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
lngrgsttsmrgvvkltttagsqsggdassalawnadvihqrggqtingtlrinntltia
sgganitgtvnmtggyiqgkrvvtqneidrtipvgaimmwaadslpsdawrfchggtvsa
sdcplyasrigtryggsssnpglpdmrglfvrgsgrgshltnpnvngndqfgkprlgvgc
tggyvgevqiqqmsyhkhaggfgehddlgafgntrrsnfvgtrkgldwdnrsyftndgye
idpesqrnskytlnrpelignetrpwnislnyiikvke

SCOPe Domain Coordinates for d1pdir_:

Click to download the PDB-style file with coordinates for d1pdir_.
(The format of our PDB-style files is described here.)

Timeline for d1pdir_: