Lineage for d1pdfr_ (1pdf R:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433883Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 433884Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 433885Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 433886Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 433887Species Bacteriophage T4 [TaxId:10665] [103678] (6 PDB entries)
  8. 433905Domain d1pdfr_: 1pdf R: [94535]
    fitting of baseplate structural protein gp11

Details for d1pdfr_

PDB Entry: 1pdf (more details)

PDB Description: fitting of gp11 crystal structure into 3d cryo-em reconstruction of bacteriophage t4 baseplate-tail tube complex

SCOP Domain Sequences for d1pdfr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdfr_ i.19.1.1 (R:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4}
srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
twnllgaqtvtldnqqtptvfyhferta

SCOP Domain Coordinates for d1pdfr_:

Click to download the PDB-style file with coordinates for d1pdfr_.
(The format of our PDB-style files is described here.)

Timeline for d1pdfr_: