Lineage for d1pdfp_ (1pdf P:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898855Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 898856Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 898857Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 898858Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 898859Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 898875Domain d1pdfp_: 1pdf P: [94533]
    fitting of baseplate structural protein gp11

Details for d1pdfp_

PDB Entry: 1pdf (more details), 12 Å

PDB Description: fitting of gp11 crystal structure into 3d cryo-em reconstruction of bacteriophage t4 baseplate-tail tube complex
PDB Compounds: (P:) baseplate structural protein gp11

SCOP Domain Sequences for d1pdfp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdfp_ i.19.1.1 (P:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
twnllgaqtvtldnqqtptvfyhferta

SCOP Domain Coordinates for d1pdfp_:

Click to download the PDB-style file with coordinates for d1pdfp_.
(The format of our PDB-style files is described here.)

Timeline for d1pdfp_: