![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.59: PAH2 domain [47761] (1 superfamily) 4 helices; open up-and-down bundle; binds alpha-helical peptides |
![]() | Superfamily a.59.1: PAH2 domain [47762] (1 family) ![]() |
![]() | Family a.59.1.1: PAH2 domain [47763] (2 proteins) |
![]() | Protein Sin3B [47764] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47765] (2 PDB entries) |
![]() | Domain d1pd7a_: 1pd7 A: [94514] complex with Mad1 peptide; chain B |
PDB Entry: 1pd7 (more details)
SCOP Domain Sequences for d1pd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd7a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus)} esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft evanlfrgqedllsefgqflpeakr
Timeline for d1pd7a_: