Lineage for d1pd7a_ (1pd7 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356769Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 356770Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 356771Family a.59.1.1: PAH2 domain [47763] (2 proteins)
  6. 356775Protein Sin3B [47764] (1 species)
  7. 356776Species Mouse (Mus musculus) [TaxId:10090] [47765] (2 PDB entries)
  8. 356778Domain d1pd7a_: 1pd7 A: [94514]
    complex with Mad1 peptide; chain B

Details for d1pd7a_

PDB Entry: 1pd7 (more details)

PDB Description: extended sid of mad1 bound to the pah2 domain of msin3b

SCOP Domain Sequences for d1pd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd7a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus)}
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

SCOP Domain Coordinates for d1pd7a_:

Click to download the PDB-style file with coordinates for d1pd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1pd7a_: