Lineage for d1pd3b_ (1pd3 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267844Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1267904Superfamily a.30.3: Nonstructural protein ns2, Nep, M1-binding domain [101156] (1 family) (S)
    automatically mapped to Pfam PF00601
  5. 1267905Family a.30.3.1: Nonstructural protein ns2, Nep, M1-binding domain [101157] (1 protein)
  6. 1267906Protein Nonstructural protein ns2, Nep, M1-binding domain [101158] (1 species)
  7. 1267907Species Influenza A virus [TaxId:11320] [101159] (1 PDB entry)
  8. 1267909Domain d1pd3b_: 1pd3 B: [94513]

Details for d1pd3b_

PDB Entry: 1pd3 (more details), 2.6 Å

PDB Description: Influenza A NEP M1-binding domain
PDB Compounds: (B:) Nonstructural protein NS2

SCOPe Domain Sequences for d1pd3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd3b_ a.30.3.1 (B:) Nonstructural protein ns2, Nep, M1-binding domain {Influenza A virus [TaxId: 11320]}
gkwreqlgqkfeeirwlieevrhrlkitensfeqitfmqalqllleveqeirtf

SCOPe Domain Coordinates for d1pd3b_:

Click to download the PDB-style file with coordinates for d1pd3b_.
(The format of our PDB-style files is described here.)

Timeline for d1pd3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pd3a_