Class a: All alpha proteins [46456] (284 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.3: Nonstructural protein ns2, Nep, M1-binding domain [101156] (1 family) |
Family a.30.3.1: Nonstructural protein ns2, Nep, M1-binding domain [101157] (1 protein) |
Protein Nonstructural protein ns2, Nep, M1-binding domain [101158] (1 species) |
Species Influenza A virus [TaxId:11320] [101159] (1 PDB entry) |
Domain d1pd3b_: 1pd3 B: [94513] |
PDB Entry: 1pd3 (more details), 2.6 Å
SCOP Domain Sequences for d1pd3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd3b_ a.30.3.1 (B:) Nonstructural protein ns2, Nep, M1-binding domain {Influenza A virus [TaxId: 11320]} gkwreqlgqkfeeirwlieevrhrlkitensfeqitfmqalqllleveqeirtf
Timeline for d1pd3b_: