SCOPe 2.03: Domain d1pd3a_: 1pd3 A:

Lineage for d1pd3a_ (1pd3 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.3: Nonstructural protein ns2, Nep, M1-binding domain [101156] (1 family)
   automatically mapped to Pfam PF00601

5. Family a.30.3.1: Nonstructural protein ns2, Nep, M1-binding domain [101157] (1 protein)

6. Protein Nonstructural protein ns2, Nep, M1-binding domain [101158] (1 species)

7. Species Influenza A virus [TaxId:11320] [101159] (1 PDB entry)

8. Domain d1pd3a_: 1pd3 A: [94512]

Details for d1pd3a_

PDB Entry: 1pd3, 2.6 Å

PDB Description: Influenza A NEP M1-binding domain

PDB Compounds: (A:) Nonstructural protein NS2

SCOPe Domain Sequences for d1pd3a_:

Sequence; same for both SEQRES and ATOM records:

>d1pd3a_ a.30.3.1 (A:) Nonstructural protein ns2, Nep, M1-binding domain {Influenza A virus [TaxId: 11320]}
gkwreqlgqkfeeirwlieevrhrlkitensfeqitfmqalqllleveqeirtf

Timeline for d1pd3a_:

• d1pd3a_ first appeared in SCOP 1.67
  
• d1pd3a_ appears in SCOPe 2.02
  
• d1pd3a_ appears in SCOPe 2.04
  
• d1pd3a_ appears in the current release, SCOPe 2.08