Lineage for d1pd3a_ (1pd3 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354822Fold a.30: ROP-like [47379] (4 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 354856Superfamily a.30.3: Nonstructural protein ns2, Nep, M1-binding domain [101156] (1 family) (S)
  5. 354857Family a.30.3.1: Nonstructural protein ns2, Nep, M1-binding domain [101157] (1 protein)
  6. 354858Protein Nonstructural protein ns2, Nep, M1-binding domain [101158] (1 species)
  7. 354859Species Influenza A virus [TaxId:11320] [101159] (1 PDB entry)
  8. 354860Domain d1pd3a_: 1pd3 A: [94512]

Details for d1pd3a_

PDB Entry: 1pd3 (more details), 2.6 Å

PDB Description: Influenza A NEP M1-binding domain

SCOP Domain Sequences for d1pd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd3a_ a.30.3.1 (A:) Nonstructural protein ns2, Nep, M1-binding domain {Influenza A virus}
gkwreqlgqkfeeirwlieevrhrlkitensfeqitfmqalqllleveqeirtf

SCOP Domain Coordinates for d1pd3a_:

Click to download the PDB-style file with coordinates for d1pd3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pd3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pd3b_