SCOP 1.71: Domain d1pd1a5: 1pd1 A:216-300

Lineage for d1pd1a5 (1pd1 A:216-300)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family)

5. Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)

6. Protein Sec24 [82923] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries)

8. Domain d1pd1a5: 1pd1 A:216-300 [94511]
   Other proteins in same PDB: d1pd1a1, d1pd1a2, d1pd1a3, d1pd1a4
   complexed with a snare peptide
   complexed with zn

Details for d1pd1a5

PDB Entry: 1pd1, 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide containing the DxE cargo sorting signal of yeast Sys1 protein

SCOP Domain Sequences for d1pd1a5:

Sequence, based on SEQRES records:

>d1pd1a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq

Sequence, based on observed residues (ATOM records):

>d1pd1a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqpksrydr
neikcavmeymapkeytlrq

Timeline for d1pd1a5:

• d1pd1a5 first appeared in SCOP 1.67
  
• d1pd1a5 appears in SCOP 1.69
  
• d1pd1a5 appears in SCOP 1.73
  
• d1pd1a5 appears in the current release, SCOPe 2.08