Lineage for d1pd1a5 (1pd1 A:216-300)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2588388Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 2588389Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 protein domains)
  6. 2588396Protein Sec24 [82923] (1 species)
  7. 2588397Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries)
  8. 2588398Domain d1pd1a5: 1pd1 A:216-300 [94511]
    Other proteins in same PDB: d1pd1a1, d1pd1a2, d1pd1a3, d1pd1a4
    complexed with a snare peptide
    complexed with zn

Details for d1pd1a5

PDB Entry: 1pd1 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide containing the DxE cargo sorting signal of yeast Sys1 protein
PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pd1a5:

Sequence, based on SEQRES records: (download)

>d1pd1a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq

Sequence, based on observed residues (ATOM records): (download)

>d1pd1a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqpksrydr
neikcavmeymapkeytlrq

SCOPe Domain Coordinates for d1pd1a5:

Click to download the PDB-style file with coordinates for d1pd1a5.
(The format of our PDB-style files is described here.)

Timeline for d1pd1a5: