Lineage for d1pd1a4 (1pd1 A:754-926)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609305Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609423Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 609424Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)
  6. 609430Protein Sec24 [82758] (1 species)
  7. 609431Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82759] (4 PDB entries)
  8. 609433Domain d1pd1a4: 1pd1 A:754-926 [94510]
    Other proteins in same PDB: d1pd1a1, d1pd1a2, d1pd1a3, d1pd1a5
    complexed with a snare peptide
    complexed with zn

Details for d1pd1a4

PDB Entry: 1pd1 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide containing the DxE cargo sorting signal of yeast Sys1 protein

SCOP Domain Sequences for d1pd1a4:

Sequence, based on SEQRES records: (download)

>d1pd1a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pdvyslhdmadeaglpvqtedgeatgtivlpqpinatsslferyglylidngnelflwmg
gdavpalvfdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyi
vrgaslsepvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk

Sequence, based on observed residues (ATOM records): (download)

>d1pd1a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pdvyslhdmadeaglpvgtivlpqpinatsslferyglylidngnelflwmggdavpalv
fdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyivrgaarev
atlrlwasstlvedkilnnesyreflqimkarisk

SCOP Domain Coordinates for d1pd1a4:

Click to download the PDB-style file with coordinates for d1pd1a4.
(The format of our PDB-style files is described here.)

Timeline for d1pd1a4: