Lineage for d1pd1a2 (1pd1 A:133-215,A:553-646)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 457051Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) (S)
  5. 457052Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins)
  6. 457058Protein Sec24 [81999] (1 species)
    includes the N-terminal tail
  7. 457059Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries)
  8. 457060Domain d1pd1a2: 1pd1 A:133-215,A:553-646 [94508]
    Other proteins in same PDB: d1pd1a1, d1pd1a3, d1pd1a4, d1pd1a5
    complexed with a snare peptide

Details for d1pd1a2

PDB Entry: 1pd1 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide containing the DxE cargo sorting signal of yeast Sys1 protein

SCOP Domain Sequences for d1pd1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd1a2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
rpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspdyirstlnavpkn
ssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghffnrssdlcafstm
prdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasa

SCOP Domain Coordinates for d1pd1a2:

Click to download the PDB-style file with coordinates for d1pd1a2.
(The format of our PDB-style files is described here.)

Timeline for d1pd1a2: