Lineage for d1pd0a5 (1pd0 A:216-300)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524497Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) (S)
  5. 524498Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)
  6. 524504Protein Sec24 [82923] (1 species)
  7. 524505Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82924] (4 PDB entries)
  8. 524509Domain d1pd0a5: 1pd0 A:216-300 [94506]
    Other proteins in same PDB: d1pd0a1, d1pd0a2, d1pd0a3, d1pd0a4
    complexed with a snare peptide

Details for d1pd0a5

PDB Entry: 1pd0 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)

SCOP Domain Sequences for d1pd0a5:

Sequence, based on SEQRES records: (download)

>d1pd0a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqsdpndpk
srydrneikcavmeymapkeytlrq

Sequence, based on observed residues (ATOM records): (download)

>d1pd0a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
didppplnedglivrcrrcrsymnpfvtfieqgrrwrcnfcrlandvpmqmdqpksrydr
neikcavmeymapkeytlrq

SCOP Domain Coordinates for d1pd0a5:

Click to download the PDB-style file with coordinates for d1pd0a5.
(The format of our PDB-style files is described here.)

Timeline for d1pd0a5: